PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00770g00128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 458aa    MW: 51140.8 Da    PI: 9.5139
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00770g00128.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.34e-09130172346
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               +WT+eE ++l d++k++  + +  Ia +++++Rt +++k+r+++
  Peaxi162Scf00770g00128.1 130 SWTKEETDQLFDLCKRFDLR-FVIIADRFPLNRTVEELKDRYYS 172
                               7*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162822.6E-31103177IPR032563DAMP1, SANT/Myb-like domain
SuperFamilySSF466891.47E-7116177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-6126174IPR009057Homeodomain-like
SMARTSM007176.6E-10127176IPR001005SANT/Myb domain
CDDcd116582.05E-19131173No hitNo description
PfamPF054993.1E-6320383IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MDAKDILGLP KNGPTMPQEK KSRPQKESQR KPDGISREVY ALTGGIAPLM PTLDINQLKR  60
RAQSESEKIT WQWLPFTSSA RKDNLQLYHW VRVVNGVPPA GDYSFAKFNK SVDVLEYTNE  120
EYEKHLSSPS WTKEETDQLF DLCKRFDLRF VIIADRFPLN RTVEELKDRY YSVSRAITVA  180
RAASPADVAG HPLVKEPYNA SQETERKRAL NMVLSQTKLQ ERRDAEVLAE AKRISESRRA  240
AKAAEAAAEM ELPVVSDAGA EGAEKAIGID AISTSPNAQL TSGIAAPPVS ETATTLASLR  300
MLRVYLRTYA LEQMVQAASS SAGLRTIKRV EQTLQDLGVN LKPKVPTKLV CAEHLELRKE  360
ILTLLNLQKQ LQYKEAEGSS YREASYTETP ETPPKRAQRA TDLDRTFIPD STSFGGDRAG  420
KRDQKRKGPG RLSEVPSSPA QQIFAPRTER EHESSTTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A2e-21102187493DNA methyltransferase 1-associated protein 1
4iej_A2e-21102187493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135620.0BT013562.1 Lycopersicon esculentum clone 132299F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349165.10.0PREDICTED: SWR1-complex protein 4
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLM1AI920.0M1AI92_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000233830.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76261515
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein